PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_2026g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 540aa    MW: 60627 Da    PI: 8.0446
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_2026g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81e-074775129
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIar 29
                     +g+WT+eEde+l+  ++ +G g W++ ++
     MA_2026g0010 47 KGAWTKEEDERLIAHIRAHGEGGWRSLPK 75
                     79**********************99775 PP

2Myb_DNA-binding41.53e-13101148148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ed +l+  ++ +G g W++ +r  g+ R++k+c++rw +yl
     MA_2026g0010 101 KGAWTQLEDARLIAHIRAHGEGGWRSLPRAAGLLRCGKSCRLRWINYL 148
                      79******************************99************97 PP

3Myb_DNA-binding57.92.4e-18154198147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia+++  gRt++++k++w++y
     MA_2026g0010 154 RGNFTEEEDELIIKLHSLLGNK-WSLIAARLS-GRTDNEIKNYWNTY 198
                      89********************.*********.************99 PP

4Myb_DNA-binding54.33.2e-17328372147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eEdel+++++ +lG++ W++Ia ++  gRt++++k++w+++
     MA_2026g0010 328 RGNFSEEEDELIIKLHSLLGNK-WSLIAGRLS-GRTDNEIKNYWNTH 372
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-103876IPR009057Homeodomain-like
SuperFamilySSF466894.83E-64276IPR009057Homeodomain-like
PROSITE profilePS500907.2824292IPR017877Myb-like domain
SMARTSM00717104692IPR001005SANT/Myb domain
PfamPF002491.9E-54775IPR001005SANT/Myb domain
CDDcd001679.50E-44975No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2092151IPR009057Homeodomain-like
PROSITE profilePS5129412.44796148IPR017930Myb domain
SMARTSM007178.0E-10100150IPR001005SANT/Myb domain
SuperFamilySSF466894.39E-27100195IPR009057Homeodomain-like
PfamPF002497.3E-11101148IPR001005SANT/Myb domain
CDDcd001675.43E-7103148No hitNo description
PROSITE profilePS5129429.143149203IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-27152203IPR009057Homeodomain-like
SMARTSM007179.1E-18153201IPR001005SANT/Myb domain
PfamPF002491.1E-16154198IPR001005SANT/Myb domain
CDDcd001671.22E-12156199No hitNo description
PROSITE profilePS5129425.19323377IPR017930Myb domain
SMARTSM007171.2E-16327375IPR001005SANT/Myb domain
SuperFamilySSF466893.01E-14327387IPR009057Homeodomain-like
PfamPF002492.6E-15328372IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-23329374IPR009057Homeodomain-like
CDDcd001671.16E-11330373No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MATGDGYITL LFSCYPFHSE LVTVPISRRL HVKMGRSPCC EKAHTNKGAW TKEEDERLIA  60
HIRAHGEGGW RSLPKAAVSI SCSLPVKMGR SPCCEKAHTN KGAWTQLEDA RLIAHIRAHG  120
EGGWRSLPRA AGLLRCGKSC RLRWINYLRP DLKRGNFTEE EDELIIKLHS LLGNKWSLIA  180
ARLSGRTDNE IKNYWNTYIK RKLLSRGLDP QTHRPLCPPH NSNTILSFVP VPEHKILAFQ  240
SPRAVEIADF FQHDRSKSLP IEPAACKDEE HPDLNLDLCI SLPSNPSHAE NRASSVDRTL  300
DSNFNSGRGL CCAHTGPQIN PNGRYLKRGN FSEEEDELII KLHSLLGNKW SLIAGRLSGR  360
TDNEIKNYWN THIKRKLLSR GLDPQTHRPL CPPHNSNTIL SFPPVPEHEI SAFQSQRAAE  420
IADFFQHDRS ECLPIEXXXX XXEIADFFQH DRSECLPIEP AASKDEEHPD LNLDLCMSLP  480
SNSSHAENRA SSVDRTVDAN FNPGRGLCCA HIGPQTNSGG RCGNRYCERN HGGFSHRVGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-27432032159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-27432032159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1024310.0BT102431.1 Picea glauca clone GQ0192_I12 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028718.12e-87PREDICTED: myb-related protein 308-like
SwissprotQ9SZP13e-83MYB4_ARATH; Transcription repressor MYB4
TrEMBLA5JYE91e-122A5JYE9_PICGL; R2R3-MYB transcription factor MYB5
STRINGPGSC0003DMT4000343723e-82(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-84myb domain protein 4